Analytical Data
-
Gene name
GNB1L
- Application
-
Alternative Names
GNB1L；GY2；KIAA1645；WDR14；Guanine nucleotide-binding Protein subunit beta-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYB4
-
Expression Region
1-327aa
-
AA Sequence
MTAPCPPPPPDPQFVLRGTQSPVHALHFCEGAQAQGRPLLFSGSQSGLVHIWSLQTRRAVTTLDGHGGQCVTWLQTLPQGRQLLSQGRDLKLCLWDLAEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIRVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRISLWSLYPRA
-
Molecular Weight
62.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GNB1L, or Guanine nucleotide-binding protein subunit beta-like, is a critical component in the signaling pathways of cells, playing a significant role in various physiological processes. The study of GNB1L recombinant proteins has gained attention due to their potential implications in understanding cellular communications and their involvement in diseases. These proteins are essential for the proper function of G-protein coupled receptors (GPCRs), which are pivotal in transmitting signals from outside the cell to the inside, thereby influencing numerous biological functions such as growth, metabolism, and neuronal signaling. Mutations or dysregulation in GNB1L have been linked to several disorders, including developmental and neuropsychiatric conditions. Utilizing recombinant proteins allows researchers to investigate the structural and functional characteristics of GNB1L, as well as to explore its interactions with other cellular components. This research is vital for identifying the molecular mechanisms behind its functions and could lead to the development of therapeutic strategies targeting GNB1L-related pathways. Furthermore, advances in recombinant protein technology facilitate the production of large quantities of GNB1L for further studies, enhancing our understanding of its role in health and disease.
