Cat: PA1000-7805

Recombinant Human NADK Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NADK

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NADK;NAD kinase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95544

  • Expression Region

    64-446aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMSLHGPCPVTTFGPKACVLQNPQTIMHIQD PASQRLTWNK SPKSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEKKVLEDPAIASDE SFGAVKKKFC TFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFL TPFSFENFQS QVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGEKGSQAAGLDMD VGKQAMQYQV LNEVVIDRGPSSYLSN

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NADK (NAD kinase) is a crucial enzyme involved in the regulation of cellular NAD(P)H levels, impacting various metabolic pathways and cellular functions. NADK catalyzes the phosphorylation of NAD+ to NADP+, which is essential for maintaining the balance of reducing equivalents in cells, particularly in processes like fatty acid synthesis, steroidogenesis, and antioxidant defense. Recent studies emphasize its potential role in various diseases, including cancer, metabolic disorders, and neurodegenerative conditions, where altered NADP+ levels can contribute to pathophysiology. Recombinant NADK proteins are increasingly being produced for biochemical studies, allowing researchers to delve deeper into the enzyme's structure-function relationships. These studies often involve the cloning, expression, and purification of NADK to investigate its kinetics, regulation, and interaction with other metabolic enzymes. Understanding these aspects is pivotal for developing therapeutic strategies that target NADK, which may help restore metabolic balance in diseased states. Furthermore, the exploration of NADK's role in redox homeostasis has opened new avenues for research, emphasizing the importance of this enzyme in both basic and applied biological sciences. 

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US