Analytical Data
-
Gene name
MTIF3
- Application
-
Alternative Names
MTIF3；Translation initiation factor IF-3. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H2K0
-
Expression Region
1-278aa
-
AA Sequence
TAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
-
Molecular Weight
55.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTIF3 (Mitochondrial Translation Initiation Factor 3) is a crucial protein involved in the initiation of mitochondrial translation, playing a significant role in the proper synthesis of mitochondrial-encoded proteins. These proteins are essential for various mitochondrial functions, including energy production, oxidative phosphorylation, and overall cellular metabolism. Research on MTIF3 has gained importance due to its implications in mitochondrial diseases, which can arise from mutations affecting mitochondrial translation. Defective mitochondrial protein synthesis can lead to a cascade of metabolic dysfunctions, resulting in conditions that may manifest as neurodegenerative disorders, myopathies, and metabolic syndromes. Understanding the structure and function of MTIF3 can provide insights into the mechanisms of mitochondrial protein synthesis and the potential link to pathogenic processes. Moreover, MTIF3 may serve as a valuable biomarker for mitochondrial dysfunction and a target for therapeutic strategies aimed at treating mitochondrial diseases. Recent advances in molecular biology techniques, including cryo-electron microscopy and high-throughput sequencing, have facilitated a deeper investigation into the dynamics of mitochondrial translation and the role of factors like MTIF3. Thus, ongoing research in this area holds promise for uncovering novel therapeutic avenues for alleviating the burden of mitochondrial-related disorders and enhancing our understanding of mitochondrial biology.
