Analytical Data
-
Gene name
TEAD3
- Application
-
Alternative Names
TEAD3；TEAD5；TEF5；Transcriptional enhancer factor TEF-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99594
-
Expression Region
112-435aa
-
AA Sequence
MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD
-
Molecular Weight
43.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TEAD3, a member of the TEA domain family of transcription factors, plays a crucial role in regulating gene expression related to cell proliferation, differentiation, and tissue development. It is particularly significant in the context of the Hippo signaling pathway, which is a critical regulator of organ size and cellular growth. Dysregulation of TEAD3 has been implicated in various cancers, highlighting its potential as a therapeutic target. The study of recombinant TEAD3 proteins has gained attention for its applications in understanding the molecular mechanisms underlying transcriptional regulation and cellular responses in different biological contexts. By expressing and purifying TEAD3 as a recombinant protein, researchers can investigate its binding interactions with other proteins, DNA, and small molecules. This research not only enhances our comprehension of normal physiological processes but also contributes to the development of novel strategies for cancer treatment. The use of recombinant TEAD3 proteins thus serves as a foundational tool in both basic and applied biomedical research, paving the way for innovative therapeutic interventions aimed at diseases characterized by aberrant TEAD3 activity.
