Analytical Data
-
Gene name
SMCR7
- Application
-
Alternative Names
MGC23130; MID49; MID49_HUMAN; MIEF2; Mitochondrial dynamic protein MID49; Mitochondrial dynamic protein of 49 kDa; Mitochondrial dynamics protein MID49; Mitochondrial dynamics protein of 49 kDa; Mitochondrial elongation factor 2; Smith Magenis syndrome chromosome region candidate 7; Smith-Magenis syndrome chromosomal region candidate gene 7 protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96C03
-
Expression Region
1-454 aa
-
AA Sequence
MAEFSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDRATSPRDEDDTKADSWKELSLLKATPHLQPRPPPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLLVPLVLEPGLWSLVPGVDTVARDPRCWAVRRTQLEFCPRGSSPWDRFLVGGYLSSRVLLELLRKALAASVNWPAIGSLLGCLIRPSMASEELLLEVQHERLELTVAVLVAVPGVDADDRLLLAWPLEGLAGNLWLQDLYPVEAARLRALDDHDAGTRRRLLLLLCAVCRGCSALGQLGRGHLTQVVLRLGEDNVDWTEEALGERFLQALELLIGSLEQASLPCHFNPSVNLFSSLREEEIDDIGYALYSGLQEPEGLL
-
Molecular Weight
75.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMCR7 is a relatively newly identified protein that plays a crucial role in various cellular processes, including DNA repair, cell cycle regulation, and stress response. Research into SMCR7 has gained traction due to its potential implications in cancer biology and therapeutic interventions. Studies have suggested that the dysregulation of SMCR7 could be linked to several malignancies, making it a candidate for further exploration in cancer research. Additionally, its involvement in fundamental cellular mechanisms raises questions about its role in other diseases. The generation of recombinant SMCR7 proteins facilitates in-depth studies of its structure and function, allowing for the characterization of its interaction with other cellular components. Understanding the biochemical pathways associated with SMCR7 may pave the way for novel strategies in disease treatment by targeting its regulatory mechanisms. With advancing techniques in molecular biology and biochemistry, SMCR7 has become a focus of investigation to elucidate its biological significance and therapeutic potential.
