Analytical Data
-
Gene name
DACT1
- Application
-
Alternative Names
Dact; dact1; DACT1_HUMAN; Dapper antagonist of beta catenin homolog 1; Dapper antagonist of catenin 1; Dapper; Dapper homolog 1; DAPPER1; Dpr; Dpr1; Frd; Frodo; hDPR1; Hepatocellular carcinoma novel gene 3 protein; Heptacellular carcinoma novel gene 3; HNG3; MTNG3; Thyex3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYF0
-
Expression Region
738-836aa
-
AA Sequence
VVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DACT1 (Dishevelled Acylation-Dependent Catenin Alpha-1) is a crucial protein involved in the Wnt signaling pathway, which plays a significant role in cell proliferation, differentiation, and embryonic development. The regulation of this pathway is vital for maintaining cellular homeostasis and tissue integrity. Aberrant Wnt signaling has been implicated in various diseases, including cancer, where it can contribute to tumorigenesis and metastasis. Understanding the structure and function of DACT1 is essential for elucidating its role in these biological processes. Recent studies have focused on the recombinant production of DACT1 to facilitate in-depth investigations into its molecular mechanisms and interactions with other signaling proteins. The development of recombinant DACT1 enables researchers to perform biophysical analyses, structural studies, and functional assays, providing valuable insights into its regulatory mechanisms. Moreover, by exploring the potential post-translational modifications and interaction networks of DACT1, researchers aim to identify novel therapeutic targets for conditions arising from dysregulated Wnt signaling. This research is paving the way for innovative strategies to manipulate the Wnt pathway in disease contexts, ultimately contributing to the development of targeted therapies.
