Analytical Data
-
Gene name
SPS1
- Application
-
Alternative Names
SPS1；SELD；SPS；SPS1；Selenide. water dikinase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19623
-
Expression Region
17-302aa
-
AA Sequence
REGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS
-
Molecular Weight
59.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPS1 is a key protein involved in various cellular processes, and its recombinant form has garnered attention in recent years for its potential applications in biotechnology and medicine. Research into SPS1 recombinant protein stems from its fundamental role in cellular signaling and regulation, influencing pathways that are crucial for cell growth, differentiation, and response to environmental stress. The ability to produce SPS1 as a recombinant protein allows for detailed studies of its biochemical properties and interactions with other cellular components. This can lead to a better understanding of its function in physiological and pathological conditions, such as cancer and metabolic disorders. Moreover, the recombinant SPS1 protein can be utilized in developing diagnostic tools or therapeutic strategies, given its involvement in critical biological pathways. The advancements in recombinant DNA technology have facilitated the production of SPS1 in various expression systems, enabling researchers to explore its structural characteristics and functional mechanisms more effectively. As a result, the study of SPS1 recombinant protein is not only significant for basic science but also holds promise for practical applications in health and disease management.
