Analytical Data
-
Gene name
C1QTNF3
- Application
-
Alternative Names
C1QTNF3；CTRP3；Complement C1q tumor necrosis factor-related Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
N-6His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BXJ4
-
Expression Region
23-246aa
-
AA Sequence
QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
-
Molecular Weight
28kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
C1QTNF3, also known as C1q and TNF related protein 3, is a member of the C1q/TNF superfamily, which plays a pivotal role in various biological processes, including immune response and metabolic regulation. Research has identified C1QTNF3 as a potential biomarker for various diseases, including obesity, type 2 diabetes, and cardiovascular disorders, due to its involvement in inflammatory pathways and adipocyte function. Studies show that C1QTNF3 is secreted by adipose tissue and can influence insulin sensitivity and glucose metabolism, thereby linking it to metabolic syndrome. Additionally, its expression levels are reported to be altered in different pathological conditions, suggesting that C1QTNF3 may have both diagnostic and therapeutic implications. Understanding the functional mechanisms of C1QTNF3 is crucial for elucidating its role in health and disease, paving the way for targeted interventions in metabolic disorders. Furthermore, as research progresses, the potential for C1QTNF3 in drug development and therapeutic applications continues to emerge, highlighting the importance of elucidating its structure and function at a molecular level to explore new avenues for treatment strategies. Thus, investigating C1QTNF3 recombinant protein serves as a promising approach to enhance our understanding of its biological significance and its potential in clinical applications.
