Analytical Data
-
Gene name
NFYA3
- Application
-
Alternative Names
NFYA3；HAP2C；Nuclear transcription factor Y subunit A-3
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q93ZH2
-
Expression Region
1-340aa
-
AA Sequence
MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI
-
Molecular Weight
41.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NFYA3, a member of the NF-Y transcription factor family, plays a crucial role in various biological processes, including cell cycle regulation, DNA repair, and response to stress. Its function is tightly linked to the regulation of gene expression, particularly in developmental and physiological contexts. Recent studies have highlighted NFYA3's involvement in cancer progression, where its overexpression has been correlated with tumor growth and poor prognosis in several malignancies. Understanding the mechanisms by which NFYA3 regulates target genes and its interactions with other proteins is essential for elucidating its role in oncogenesis and potential as a therapeutic target. Researchers are focusing on the protein's structural characteristics, post-translational modifications, and regulatory pathways to develop novel strategies for cancer treatment. Moreover, NFYA3 serves as a model for investigating the broader implications of transcription factors in gene regulation, providing insights into the complex networks that govern cellular behavior and contribute to disease states. As the field advances, characterizing NFYA3 and its signaling pathways will be key to unveiling new diagnostic and therapeutic options.
