Analytical Data
-
Gene name
VPS13A
- Application
-
Alternative Names
VPS13A;CHAC;KIAA0986;Intermembrane lipid transfer Protein VPS13A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96RL7
-
Expression Region
3037-3140aa
-
AA Sequence
RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF
-
Molecular Weight
28.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VPS13A, a vital gene implicated in the regulation of intracellular trafficking and membrane dynamics, has garnered significant attention in the field of molecular biology and genetics. Mutations in the VPS13A gene are associated with Chorea-Acanthocytosis (ChAc), a rare neurodegenerative disorder characterized by movement disorders, cognitive decline, and distinctive acanthocytes in the bloodstream. Research into VPS13A offers insights into the mechanisms underlying cellular homeostasis and the pathogenesis of related diseases. The gene encodes a large, multi-domain protein that plays a crucial role in transporting lipids and proteins between different organelles. Understanding the structure-function relationships of VPS13A is critical for elucidating its biological roles and potential therapeutic targets. Furthermore, studies on VPS13A-related pathways may reveal novel aspects of cellular communication and lipid metabolism, contributing to a broader understanding of neurodegenerative processes. As researchers continue to explore the intricate functions of VPS13A, the findings may pave the way for the development of targeted treatments aimed at mitigating the effects of ChAc and similar conditions. The ongoing investigation of VPS13A and its protein interactions highlights its importance as a key player in maintaining neuronal health and integrity, emphasizing the need for continued research in this promising area of study.











