Cat: PA2000-3328

Recombinant Human VPS13A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VPS13A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VPS13A;CHAC;KIAA0986;Intermembrane lipid transfer Protein VPS13A

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96RL7

  • Expression Region

    3037-3140aa

  • AA Sequence

    RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF

  • Molecular Weight

    28.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VPS13A, a vital gene implicated in the regulation of intracellular trafficking and membrane dynamics, has garnered significant attention in the field of molecular biology and genetics. Mutations in the VPS13A gene are associated with Chorea-Acanthocytosis (ChAc), a rare neurodegenerative disorder characterized by movement disorders, cognitive decline, and distinctive acanthocytes in the bloodstream. Research into VPS13A offers insights into the mechanisms underlying cellular homeostasis and the pathogenesis of related diseases. The gene encodes a large, multi-domain protein that plays a crucial role in transporting lipids and proteins between different organelles. Understanding the structure-function relationships of VPS13A is critical for elucidating its biological roles and potential therapeutic targets. Furthermore, studies on VPS13A-related pathways may reveal novel aspects of cellular communication and lipid metabolism, contributing to a broader understanding of neurodegenerative processes. As researchers continue to explore the intricate functions of VPS13A, the findings may pave the way for the development of targeted treatments aimed at mitigating the effects of ChAc and similar conditions. The ongoing investigation of VPS13A and its protein interactions highlights its importance as a key player in maintaining neuronal health and integrity, emphasizing the need for continued research in this promising area of study.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US