Cat: PA2000-6938

Recombinant Human CXorf40A Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CXorf40A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CXorf40A; CXorf40; EOLA1Protein CXorf40A; Endothelial-overexpressed lipopolysaccharide-associated factor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8TE69

  • Expression Region

    1-158aa

  • AA Sequence

    MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDACRELLVERLGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAALTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV

  • Molecular Weight

    44.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CXorf40A, also known as Chromosome X Open Reading Frame 40A, is an intriguing gene located on the X chromosome that has garnered attention in recent years due to its potential implications in various biological processes and diseases. Initial research suggested that CXorf40A may play a role in tumorigenesis and cellular signaling pathways, prompting scientists to explore its expression patterns and functional characteristics. The generation of recombinant CXorf40A protein has become a focal point in this research, as it allows for the detailed study of the protein's structure, function, and interactions with other cellular components. Understanding the characteristics of CXorf40A is crucial for elucidating its role in health and disease, particularly in cancer research where altered expression may correlate with tumor progression and response to therapy. Additionally, the study of this protein may provide insights into X-linked gene regulation and its implications in disorders related to chromosomal abnormalities. As a result, the investigation into CXorf40A and its recombinant protein is not only significant for its potential contribution to our understanding of fundamental biological mechanisms but also for its prospective applications in developing targeted therapies and diagnostic tools in the field of oncology and other related areas.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US