Analytical Data
-
Gene name
CXorf38
- Application
-
Alternative Names
CXorf38Uncharacterized protein CXorf38
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TB03
-
Expression Region
1-319aa
-
AA Sequence
MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHRGLLAAAPGLGPRAVCRGGSRCSPRARQFQPQCQVCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFMPRGLADKQGPEECDAVALLSLINSCDHFVVDRKKVTEVIKCRNEIMHSSEMKVSSTWLRDFQMKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDQRDGCECEMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLCLHQKLDSQEPGRQTPDRKA
-
Molecular Weight
63.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXorf38, also known as the "X chromosome open reading frame 38," is a gene located on the X chromosome that has garnered attention in recent years due to its potential implications in various biological processes. Research has indicated that CXorf38 may play a role in cellular functions, including cell signaling, apoptosis, and possibly immune responses. Its expression is often linked to specific conditions, including certain cancers and genetic disorders, making it a subject of interest in both molecular biology and medicine. The production of recombinant CXorf38 protein allows researchers to investigate its structure, functional properties, and interactions with other proteins in vitro. Such studies aim to elucidate the mechanistic pathways involving CXorf38 and assess its potential as a biomarker or therapeutic target. Understanding the role of CXorf38 at the molecular level could provide insights into its involvement in pathology and pave the way for future advancements in targeted therapies and precision medicine. Given the complexities of X-linked genes and their contributions to sex-specific diseases, the investigation of CXorf38 is particularly relevant. As research progresses, recombinant CXorf38 proteins can serve as valuable tools in exploring the functional dynamics of this gene and its potential impact on human health.
