Analytical Data
-
Gene name
CX36
- Application
-
Alternative Names
GJD2; GJA9; Gap junction delta-2 protein; Connexin-36; Cx36; Gap junction alpha-9 protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UKL4
-
Expression Region
99-197aa
-
AA Sequence
HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
-
Molecular Weight
36.63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CX36 (also known as Cx36) is a member of the connexin family of proteins, which are integral components of gap junctions, facilitating intercellular communication. Research on CX36 has gained significant importance due to its role in various physiological and pathological processes in the central nervous system. Its expression is predominantly observed in neurons, where it is crucial for the synchronization of neuronal activities and the modulation of synaptic transmission. Aberrations in CX36 function have been implicated in several neurological disorders, including epilepsy and neurodegenerative diseases. Studies suggest that CX36 may help mediate the spread of electrical signals between neurons, thereby influencing neural circuit dynamics and overall brain function. Understanding the structure and functional properties of CX36 is essential for elucidating its contributions to neural connectivity and potential therapeutic targets for CNS disorders. Recent advances in recombinant protein technology have enabled researchers to produce and analyze CX36 in vitro, paving the way for deeper investigations into its interactions, regulatory mechanisms, and potential roles in neurobiology. This research is critical not only for understanding basic neuronal communication but also for developing strategies to intervene in disease mechanisms where CX36 may play a pivotal role.
