Analytical Data
-
Gene name
TBX15
- Application
-
Alternative Names
TBX15；TBX14；T-box transcription factor TBX15
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96SF7
-
Expression Region
1-494aa
-
AA Sequence
MSSMEEIQVELQCADLWKRFHDIGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSDLSPTKPVPVGDGVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRNRTGLEAIMETYAFWRPPVRTLTFEDFTTMQKQQGGSTGTSPTTSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSGYNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYGGQLGSFPTSQFQYVMQAGNAASSSSSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMHMISPSPNNQQATNTCDGRQYGAVPGSSSQMSVH
-
Molecular Weight
70.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TBX15 is a member of the T-box family of transcription factors, which play crucial roles in the regulation of developmental processes and the differentiation of various cell types. Emerging research has highlighted TBX15’s significant involvement in adipogenesis, skeletal development, and the regulation of metabolic pathways, making it a protein of interest in studies related to obesity, metabolic syndrome, and bone disorders. Additionally, genetic variations in the TBX15 gene have been associated with body mass index and fat distribution, suggesting its potential role in influencing obesity-related traits. The recombinant expression of TBX15 provides a valuable tool for in vitro and in vivo studies aimed at elucidating its functional roles in cellular processes. By producing TBX15 as a recombinant protein, researchers can examine its interactions with other proteins, its DNA-binding capabilities, and its downstream signaling pathways. This can lead to a better understanding of the molecular mechanisms underlying its functions and contribute to the development of therapeutic strategies targeting metabolic and skeletal disorders. Overall, the study of recombinant TBX15 protein is essential for advancing our understanding of its biological significance and potential implications in health and disease.
