Analytical Data
-
Gene name
SLC25A42
- Application
-
Alternative Names
SLC25A42; Mitochondrial coenzyme A transporter SLC25A42; Solute carrier family 25 member 42
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86VD7
-
Expression Region
1-318 aa
-
AA Sequence
MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLFAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYETLKSLHREYSGRRQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGAVRGLYKGLSMNWVKGPIAVGISFTTFDLMQIMLRHLQS
-
Molecular Weight
61.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A42, a member of the solute carrier family 25, is a mitochondrial transporter that plays a crucial role in cellular metabolism, particularly in the transport of essential metabolites across the mitochondrial membrane. Recent studies have indicated that SLC25A42 is involved in various physiological processes, including ATP production and the regulation of calcium homeostasis, which are vital for maintaining cellular energy balance and overall cell function. Dysregulation of this transporter has been linked to several metabolic disorders, highlighting its potential as a therapeutic target. However, the functional mechanisms of SLC25A42 remain poorly understood due to the challenges associated with studying integral membrane proteins. To address this gap, researchers have focused on the production of recombinant SLC25A42 proteins. By employing techniques such as heterologous expression systems, scientists aim to purify and characterize this protein to elucidate its transport mechanisms and interactions with other mitochondrial components. Such studies promise to enhance our understanding of SLC25A42's role in mitochondrial function and its implications in metabolic disease, paving the way for potential biomarker development and targeted therapies in related disorders.
