Analytical Data
-
Gene name
ST8SIA4
- Application
-
Alternative Names
ST8SIA4；PST；PST1；SIAT8D；CMP-N-acetylneuraminate-poly-alpha-2.8-sialyltransferase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92187
-
Expression Region
21-168aa
-
AA Sequence
KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR
-
Molecular Weight
32.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ST8SIA4, also known as polysialyltransferase, plays a critical role in the biosynthesis of polysialic acid, a unique carbohydrate found on the surface of certain proteins. This modification is vital for various biological processes, including cell-cell interactions, neural development, and plasticity, particularly in the context of neuronal cell signaling. Research has shown that ST8SIA4 is involved in numerous physiological and pathological conditions, such as neural regeneration and cancer progression. Its dysregulation has been associated with neurodevelopmental disorders, and understanding the mechanisms underlying ST8SIA4 function may provide insights into therapeutic strategies for these conditions. Furthermore, the potential of ST8SIA4 as a biomarker for specific diseases, including certain cancers, highlights its relevance in medical research. Due to its involvement in modulating cellular behavior and maintaining neural tissue integrity, ST8SIA4 has emerged as a significant target in bioengineering and regenerative medicine. Ongoing studies are focused on the detailed characterization of ST8SIA4's enzymatic properties, its interaction with other molecular players in the glycosylation pathway, and its overall impact on cellular environments. Investigating the recombinant expression of ST8SIA4 could yield valuable information for understanding its role in health and disease, paving the way for the development of innovative therapeutic approaches and diagnostic tools.
