Analytical Data
-
Gene name
SLC25A38
- Application
-
Alternative Names
SLC25A38; Mitochondrial glycine transporter; Mitochondrial glycine transporter GlyC; Solute carrier family 25 member 38
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DW6
-
Expression Region
1-304 aa
-
AA Sequence
MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQPSDHGSRRVGMLAVLLKVVRTESLLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTRYESGKYGYESIYAALRSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITNFSCGIFAGILASLVTQPADVIKTHMQLYPLKFQWIGQAVTLIFKDYGLRGFFQGGIPRALRRTLMAAMAWTVYEEMMAKMGLKS
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A38, a member of the solute carrier family 25, is primarily recognized for its role as a mitochondrial transport protein, facilitating the exchange of metabolites across the mitochondrial membrane. Research on SLC25A38 has garnered attention due to its involvement in the regulation of intracellular energy metabolism and its potential links to various metabolic disorders. This protein is particularly important in the context of heme biosynthesis, as it is believed to transport specific metabolites required for the production of heme, an essential component of hemoglobin and other heme-containing proteins. Mutations in the SLC25A38 gene have been associated with congenital anemia, emphasizing its significance in erythropoiesis and overall cellular function. The study of recombinant SLC25A38 protein has become crucial for understanding its biochemical properties, transport mechanisms, and interaction with other cellular components. By producing and characterizing this protein in vitro, researchers aim to elucidate its functional roles and the pathological implications of its dysfunction, laying the groundwork for potential therapeutic strategies targeting metabolic diseases linked to SLC25A38. Continued exploration of SLC25A38 will not only enhance our understanding of mitochondrial biology but may also unveil novel insights into the treatment of disorders associated with impaired heme synthesis and mitochondrial dysfunction.
