Analytical Data
-
Gene name
N6AMT2
- Application
-
Alternative Names
N6AMT2；N6AMT2；EEF1A lysine methyltransferase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WVE0
-
Expression Region
2-214aa
-
AA Sequence
SDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI
-
Molecular Weight
40.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
N6AMT2, also known as N6-adenosine methyltransferase 2, has garnered significant attention in recent years due to its pivotal role in RNA modification and gene expression regulation. This enzyme is responsible for the methylation of adenosine residues in RNA, specifically at the N6 position, which is a modification known to influence RNA stability, splicing, translation, and overall cellular function. Abnormal expression or dysfunction of N6AMT2 has been implicated in various diseases, including cancers and neurological disorders, making it a potential biomarker and therapeutic target. Researchers are increasingly focusing on understanding the mechanisms by which N6AMT2 affects cellular processes, as well as the downstream effects of adenosine methylation on mRNA dynamics. The exploration of N6AMT2’s activity not only contributes to our fundamental understanding of post-transcriptional RNA regulation but also has implications for the development of novel RNA-targeted therapies. Investigating the recombinant protein form of N6AMT2 can facilitate biochemical assays, structural studies, and the design of inhibitors or modulators that could enhance or inhibit its enzymatic activity, further emphasizing its relevance in both basic research and clinical applications. As advances in biotechnology make it feasible to produce and study this enzyme in a laboratory setting, the functional characterization of N6AMT2 is expected to shed light on its biological significance and potential therapeutic interventions.
