Analytical Data
-
Gene name
CSMD3
- Application
-
Alternative Names
CSMD3; KIAA1894CUB and sushi domain-containing protein 3; CUB and sushi multiple domains protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z407
-
Expression Region
3655-3707aa
-
AA Sequence
RTAPKTQYTGCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNTVCTMV
-
Molecular Weight
31.46 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CSMD3 (CUB and Sushi multiple domains 3) is a gene that has garnered increasing attention in recent years due to its association with various physiological and pathological processes, particularly in the context of cancer and neurological disorders. Research has indicated that CSMD3 may play a crucial role in cell adhesion, migration, and signaling, which are vital for maintaining tissue integrity and function. Notably, loss of CSMD3 expression has been linked to tumor progression and metastasis in several cancers, suggesting it may act as a tumor suppressor. Moreover, its involvement in the central nervous system has opened avenues for understanding its role in neurodevelopmental and neurodegenerative diseases. The production of recombinant CSMD3 protein is essential for elucidating its structure-function relationships and exploring its potential as a biomarker or therapeutic target. By utilizing techniques such as gene cloning, expression in suitable host systems, and purification, researchers aim to generate sufficient quantities of recombinant CSMD3 for functional assays and interaction studies. The ongoing investigations into CSMD3 provide valuable insights into its biological significance, paving the way for novel strategies in disease diagnosis and treatment.
