Analytical Data
-
Gene name
SLC25A27
- Application
-
Alternative Names
SLC25A27; UCP4; UNQ772/PRO1566; Mitochondrial uncoupling protein 4; UCP 4; Solute carrier family 25 member 27
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95847
-
Expression Region
1-245 aa
-
AA Sequence
MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLVNPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSDLVGSHKAIQ
-
Molecular Weight
52.69 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A27, also known as the mitochondrial carnitine/propionylcarnitine translocase, is a member of the SLC25 family of transport proteins responsible for the transport of various metabolites across the mitochondrial membrane. This particular protein plays a crucial role in the metabolism of branched-chain amino acids and certain fatty acids by facilitating the transport of propionylcarnitine, a key intermediate in energy metabolism. Mutations in the SLC25A27 gene have been associated with metabolic disorders, highlighting its importance in maintaining cellular energy homeostasis. Given the rising incidence of metabolic diseases and the increasing understanding of mitochondrial dysfunction in various pathologies, including obesity and type 2 diabetes, research into SLC25A27 and its recombinant protein form has gained traction. By studying its structure, function, and interaction with other cellular components, researchers aim to elucidate the role of SLC25A27 in metabolic pathways and identify potential therapeutic targets for related disorders. The production of recombinant SLC25A27 protein in heterologous systems allows for detailed biochemical analyses, including kinetic studies and protein interaction assays, which are essential for developing strategies to modulate its function in disease contexts. Overall, the investigation of SLC25A27's mechanisms offers promising insights into improving metabolic health and treating mitochondrial diseases.
