Cat: PA1000-7652

Recombinant Human BAK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BAK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BAK1;BAK;BCL2L7;CDN1;Bcl-2 homologous antagonist/killer

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16611

  • Expression Region

    1-211aa

  • AA Sequence

    MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAE GVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL QPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGF LGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLL GQFVVRRFFKS

  • Molecular Weight

    49 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BAK1 (BRI1-associated receptor kinase 1) is a key receptor-like kinase involved in plant immune responses and developmental processes. Its functions are mediated through its interaction with various signaling pathways, particularly in the context of plant defense against pathogens. Research has shown that BAK1 acts as a co-receptor for several plant pattern recognition receptors (PRRs), enhancing the perception of pathogen-associated molecular patterns (PAMPs) and orchestrating downstream immune responses. Given the critical role of BAK1 in plant immunity, the characterization of BAK1 recombinant proteins has become a focal point in molecular plant biology. Producing BAK1 as a recombinant protein allows researchers to study its biochemical properties, binding abilities, and interactions with other proteins in vitro. Moreover, understanding BAK1’s structure-function relationship can shed light on its precise role in signaling pathways, ultimately contributing to the development of crops with enhanced resistance to diseases. This research is vital in the context of global food security, as it can lead to innovative strategies for improving plant resilience against biotic stressors. Overall, the study of BAK1 recombinant proteins holds significant promise for advancing our knowledge of plant immunity and improving agricultural sustainability.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US