Analytical Data
-
Gene name
ACBD4
- Application
-
Alternative Names
ACBD4;Acyl-CoA-binding domain-containing Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NC06
-
Expression Region
1-305aa
-
AA Sequence
MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
-
Molecular Weight
50.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACBD4 (Acyl-CoA Binding Domain Containing 4) is a protein that plays a crucial role in lipid metabolism and cellular signaling. Recent studies have highlighted its involvement in various cellular processes, including lipid droplet formation, membrane dynamics, and the regulation of cellular stress responses. ACBD4 is known to interact with acyl-CoA molecules, which are vital for fatty acid metabolism and energy homeostasis, implicating its potential role in metabolic disorders such as obesity and diabetes. Furthermore, research has suggested that ACBD4 may influence the trafficking of specific proteins and lipids within cells, which is essential for maintaining cellular homeostasis and responding to metabolic changes. Given the increasing prevalence of metabolic diseases and the critical role of lipid metabolism in overall health, understanding the function and regulatory mechanisms of ACBD4 is paramount. Studies exploring the expression patterns of ACBD4 in various tissues and under different physiological conditions could provide insights into its functional significance. Moreover, investigating the potential of ACBD4 as a biomarker or therapeutic target for metabolic diseases is an area of growing interest. In this context, the characterization of ACBD4 through recombinant protein studies could reveal essential insights into its structure-function relationships, paving the way for future applications in medicinal biochemistry and metabolic research. The ongoing exploration of ACBD4's biological roles promises to unveil novel mechanisms underlying lipid metabolism and cellular stress responses, which may ultimately contribute to the development of targeted therapies for metabolic disorders and significantly enhance our understanding of lipid biology.











