Analytical Data
-
Gene name
CSAG3
- Application
-
Alternative Names
CSAG2; TRAG3;; CSAG3; CSAG3AChondrosarcoma-associated gene 2/3 protein; Cancer/testis antigen 24.2; CT24.2; Taxol-resistant-associated gene 3 protein; TRAG-3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5P2
-
Expression Region
1-48aa
-
AA Sequence
MSRKPRASSPLSNNHPPTPKRRGSGRFPRQPGREKGPIKEVPGTKGSP
-
Molecular Weight
5.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CSAG3 (Cancer-Testis Antigen 3) is part of a larger family of cancer-testis antigens that are typically expressed in male germ cells within the testes but are aberrantly expressed in various malignancies, including melanoma and leukemias. The unique expression pattern of CSAG3 makes it an attractive target for cancer immunotherapy, as it is largely absent in normal tissues other than the testes, minimizing potential off-target effects. Research has shown that CSAG3 can elicit an immune response, indicating its potential as a candidate for vaccine development or adoptive cell therapy. Studies have focused on understanding the immunogenicity of CSAG3, its role in tumor progression, and the mechanisms of its expression in cancer cells. Additionally, investigations have explored the pathways involved in the regulation of CSAG3 expression, providing insights into how tumors manipulate these mechanisms to evade immune surveillance. This has significant implications for the development of immunotherapeutic strategies aimed at harnessing the body’s immune system to recognize and attack cancer cells expressing CSAG3. Overall, the study of CSAG3 and other cancer-testis antigens represents a promising frontier in the search for effective cancer treatments and biomarkers for diagnosis and prognosis.
