Analytical Data
-
Gene name
SLC25A24
- Application
-
Alternative Names
SLC25A24; APC1; MCSC1; SCAMC1; Calcium-binding mitochondrial carrier protein SCaMC-1; Mitochondrial ATP-Mg/Pi carrier protein 1; Mitochondrial Ca(2+-dependent solute carrier protein 1; Small calcium-binding mitochondrial carrier protein 1; Solute carrier family 25 member 24
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NUK1
-
Expression Region
1-477 aa
-
AA Sequence
MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
-
Molecular Weight
79.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A24, a member of the solute carrier family, is known to encode a mitochondrial transporter protein essential for various cellular processes. It plays a critical role in mitochondrial metabolism, particularly in the transport of key metabolites across the mitochondrial membrane, influencing energy production and metabolic regulation. Research indicates that SLC25A24 is involved in the transport of essential compounds such as nucleotides and pyruvate, impacting cellular functions such as apoptosis, cellular stress response, and the maintenance of mitochondrial homeostasis. Mutations or dysregulation of SLC25A24 have been associated with various metabolic disorders and mitochondrial dysfunction, making it a gene of interest in biomedical research. Recombinant SLC25A24 protein studies are vital for understanding its structure-function relationships, interactions with other mitochondrial proteins, and its role in metabolic pathways. By producing and analyzing this recombinant protein, researchers aim to elucidate the molecular mechanisms underlying its function, identify potential therapeutic targets, and explore its implications in diseases linked to mitochondrial dysfunction. This research not only enhances our understanding of SLC25A24 but also contributes to the broader field of mitochondrial biology and the development of novel treatments for metabolic diseases.
