Analytical Data
-
Gene name
SLC22A9
- Application
-
Alternative Names
SLC22A9; hOAT4; OAT7; UST3; Solute carrier family 22 member 9; Organic anion transporter 7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IVM8
-
Expression Region
1-238 aa
-
AA Sequence
MAFQDLLGHAGDLWRFQILQTVFLSIFAVATYLHFMLENFTAFIPGHRCWVHILDNDTVSDNDTGALSQDALLRISIPLDSNMRPEKCRRFVHPQWQLLHLNGTFPNTSDADMEPCVDGWVYDRISFSSTIVTEWDLVCDSQSLTSVAKFVFMAGMMVGGILGGHLSDSSRVGNTQIPGHGNYIGNVPFWYCIYDPGRPGFCHSRLAYPPAGGVCTILCDLSDLKLAARVCSVAHYQQ
-
Molecular Weight
52.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC22A9, a member of the solute carrier family 22, is a gene that encodes a protein involved in the transport of organic cations, including various drugs and metabolites, across cellular membranes. Its function has garnered significant attention due to its potential implications in pharmacokinetics and the therapeutic efficacy of numerous medications. Dysregulation of SLC22A9 expression has been associated with various diseases, including cancer and metabolic disorders, suggesting its role in drug resistance and personalized medicine. Research on the recombinant SLC22A9 protein has focused on elucidating its mechanistic role in drug transport, interactions with various substrates, and physiological significance in different tissues. Additionally, understanding its 3D structure and transport mechanism can provide insights into designing better therapeutic agents and overcoming drug resistance. As such, SLC22A9 serves as a promising target for further studies aimed at improving drug delivery systems and enhancing treatment outcomes in conditions influenced by its transport capabilities.
