Analytical Data
-
Gene name
SLC16A2
- Application
-
Alternative Names
AHDS; DXS 128; DXS 128E; DXS128; DXS128 E; DXS128E; MCT 7; MCT 8; MCT7; MCT8; Monocarboxylate transporter 7; Monocarboxylate transporter 8; MOT 8; MOT8_HUMAN; MRX 22; MRX22; SLC16 A2 ; SLC16A 2; SLC16A2; Solute carrier family 16 (monocarboxylic acid transporters). member 2; Solute carrier family 16 member 2; Solute carrier family 16. member 2 (monocarboxylic acid transporter 8) ; Solute carrier family 16. member 2 (thyroid hormone transporter); Solute carrier family 16. member 2; X linked PEST containing transporter; X-linked PEST-containing transporter; XPCT
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P36021
-
AA Sequence
MGRGGGGLDVGGGGEGSRDRLSRDGLASWGAEPGGGGSGSGSSSPPSSSSCSSRNKYQPQSGSSGPSSHSPPAAMALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLHQRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
-
Molecular Weight
67.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC16A2, also known as the MCT8 (monocarboxylate transporter 8), is a crucial membrane transporter responsible for the cellular uptake of thyroid hormones, particularly triiodothyronine (T3) and thyroxine (T4), into the brain and other tissues. Mutations in the SLC16A2 gene are associated with severe neurological disorders, including Allan-Herndon-Dudley syndrome, which is characterized by developmental delays, hypotonia, and cognitive deficits. Understanding the structure and function of SLC16A2 is vital for elucidating the impact of thyroid hormones on brain development and function. The production of recombinant SLC16A2 protein is essential for in-depth biochemical studies, functional assays, and potential therapeutic applications. Notably, research on SLC16A2 has been intensified to investigate its transport mechanism, interaction with thyroid hormones, and the consequences of its dysfunction. By studying the recombinant protein, scientists aim to clarify how SLC16A2 operates at the molecular level and to explore the potential for developing targeted treatments for thyroid hormone-related disorders. Thus, the exploration of SLC16A2 represents a significant intersection of molecular biology, endocrinology, and neuroscience, offering insights into the fundamental mechanisms underlying thyroid hormone transport and its critical role in human health.
