Analytical Data
-
Gene name
S100A7A
- Application
-
Alternative Names
S100A7A；S100A15；S100A7L1；Protein S100-A7A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86SG5
-
Expression Region
2-101aa
-
AA Sequence
SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
-
Molecular Weight
13.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
S100A7A, a member of the S100 protein family, is a calcium-binding protein primarily expressed in epithelial cells and has been implicated in various biological processes. Its dysregulation has been observed in several pathological conditions, including inflammatory diseases and certain types of cancer, making it of significant interest in biomedical research. Recent studies have highlighted its role as a potential biomarker and therapeutic target due to its involvement in modulating inflammation, cell proliferation, and apoptosis. The recombination and characterization of S100A7A protein allow researchers to elucidate its functional mechanisms in cellular signaling pathways and immune responses. By producing recombinant S100A7A, scientists can study its structure-function relationship, interactions with other proteins, and effects on cellular behavior. This research not only enhances our understanding of S100A7A's biological roles but also paves the way for developing novel diagnostic and therapeutic strategies targeting diseases associated with S100A7A dysregulation. As the advances in recombinant protein techniques continue to evolve, S100A7A stands out as a promising candidate for further exploration in the context of both basic and applied biomedical sciences.
