Analytical Data
-
Gene name
COPA
- Application
-
Alternative Names
Alpha coat protein; Alpha COP; Alpha COPI; Alpha-coat protein; Alpha-COP; AlphaCOP; Coatomer protein complex subunit alpha; Coatomer subunit alpha; COP A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53621
-
Expression Region
3-100aa
-
AA Sequence
TKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTF
-
Molecular Weight
36.52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COPA (coatomer protein complex protein) is a crucial component of the COPI (coat protein complex I) transport system, which is responsible for retrograde transport from the Golgi apparatus to the endoplasmic reticulum. The study of COPA has gained significance due to its essential role in maintaining cellular homeostasis and proper protein trafficking, as well as its implications in various diseases. Mutations in the COPA gene have been linked to a rare autoimmune disorder known as COPA syndrome, characterized by features such as pulmonary alveolar proteinosis, interstitial lung disease, and autoimmune manifestations. Research into COPA has revealed its involvement in regulating intracellular transport processes, including the retrieval of escaped ER proteins and the processing of glycoproteins, highlighting its importance in the secretory pathway and cellular stress response. Additionally, understanding COPA’s structure and function could provide insights into the mechanisms underlying COPI-mediated transport and its regulation. Studying COPA not only enhances our comprehension of fundamental cellular processes but also paves the way for developing targeted therapies for diseases associated with COPA dysfunction. As the field of cell biology continues to evolve, the exploration of COPA's role in intracellular transport sheds light on broader aspects of cellular physiology and the potential for therapeutic interventions.
