Analytical Data
-
Gene name
CDK7
- Application
-
Alternative Names
CDK7；CAK；CAK1；CDKN7；Cyclin-dependent kinase 7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50613
-
Expression Region
1-346aa
-
AA Sequence
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
-
Molecular Weight
41.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDK7 (Cyclin-Dependent Kinase 7) is a pivotal enzyme involved in the regulation of the cell cycle and transcriptional control, functioning at the intersection of these critical cellular processes. As a component of the complex containing cyclin H and MAT1A, CDK7 acts as a kinase for the transcriptional cofactor CDK-activating kinase (CAK), contributing to the phosphorylation of RNA polymerase II. This phosphorylation is essential for the transition from transcription initiation to elongation, making CDK7 a crucial player in gene expression regulation. Research into CDK7 has gained momentum due to its association with various cancers and its role in the maintenance of stemness in cancer cells. Given its integral role in transcription and cell cycle regulation, CDK7 is increasingly recognized as a promising therapeutic target. Inhibitors of CDK7 are being explored for their potential to not only halt tumor cell proliferation but also to induce differentiation in malignant cells. Additionally, studies have highlighted the enzyme's involvement in mediating responses to DNA damage and its potential effects on therapeutic resistance. As such, understanding CDK7’s structure, function, and regulatory mechanisms will not only deepen our comprehension of cell biology but also aid in the development of innovative cancer treatments. The examination of CDK7's interactions, post-translational modifications, and its broader impact on oncogenic signaling pathways is essential for elucidating its role in both normal physiology and disease states.
