Analytical Data
-
Gene name
cdtB
- Application
-
Alternative Names
cdtB；BIGH3；Transforming growth factor-beta-induced Protein ig-h3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q46669
-
Expression Region
19-269aa
-
AA Sequence
DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPS TAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLAL VSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVE EVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPA AATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSR R
-
Molecular Weight
47 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CdtB is a crucial component of the cytolethal distending toxin (CDT) produced by certain pathogenic bacteria, such as *Haemophilus ducreyi* and *Campylobacter jejuni*. This toxin exhibits a unique ability to induce cell cycle arrest and apoptosis in eukaryotic cells, making it a significant subject of research in microbiology and cell biology. The functional mechanism of CdtB involves its translocation into host cells, where it acts as a DNase, targeting and cleaving nuclear DNA, leading to cellular distension and ultimately cell death. Understanding the structure and function of recombinant CdtB proteins is essential for elucidating their role in pathogenesis and potential therapeutic applications. Research has demonstrated that recombinant CdtB can be expressed in heterologous systems, allowing for detailed studies of its enzymatic activity, interactions with host cell components, and contributions to disease progression. Additionally, characterizing the immunogenic properties of CdtB may pave the way for the development of vaccines or diagnostic tools against CDT-producing pathogens. As interest in microbial virulence factors grows, CdtB stands out as a model system for exploring bacterial-host interactions, cell cycle regulation, and the development of novel antimicrobial strategies. Thus, the research surrounding recombinant CdtB not only enhances our understanding of bacterial toxins but also contributes to the broader field of infectious disease and host defense mechanisms.
