Analytical Data
-
Gene name
Milr1
- Application
-
Alternative Names
Milr1；C17orf60；MCA32；Allergin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z6M3
-
Expression Region
249-343aa
-
AA Sequence
LPKYKTRKAMRNNVPRDRGDTAMEVGIYANILEKQAKEESVPEVGSRPCVSTAQDEAKHSQELQYATPVFQEVAPREQEACDSYKSGYVYSELNF
-
Molecular Weight
26.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Milr1, or "myeloid-specific immunoglobulin-like receptor 1," is a receptor protein primarily expressed in myeloid cells such as monocytes and macrophages. Its role in immune regulation has garnered significant interest in recent years. Research indicates that Milr1 may be involved in modulating inflammatory responses, which could have implications for various diseases, including autoimmune disorders and cancer. The exact mechanisms through which Milr1 exerts its effects, including its interaction with other signaling pathways and its influence on cell differentiation and function, remain to be fully elucidated. Additionally, recombinant Milr1 proteins are being explored as potential therapeutic agents, either as immune modulators or as tools for understanding the receptor’s biological functions. The development of these recombinant proteins requires precise expression and purification techniques to ensure their functional integrity, enabling further investigations into their potential roles in immune responses. Overall, the study of Milr1 and its recombinant forms promises to contribute significantly to our understanding of innate immunity and its manipulation for therapeutic purposes.
