Analytical Data
-
Gene name
RNASET2
- Application
-
Alternative Names
RNASET2；RNASE6PL；Ribonuclease T2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00584
-
Expression Region
25-256aa
-
AA Sequence
DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH
-
Molecular Weight
56.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNASET2, or ribonuclease T2, is a member of the T2 ribonuclease family that plays a crucial role in RNA metabolism and degradation. It has garnered attention due to its potential implications in various biological processes, including viral defense, gene regulation, and cellular stress responses. The study of RNASET2 is particularly significant in the context of cancer biology, as aberrations in its expression have been linked to tumor progression and metastasis. Additionally, RNASET2 is known to exhibit antimicrobial properties, adding to its relevance in the field of immunology. Advances in recombinant protein technology have enabled researchers to produce RNASET2 in vitro, facilitating in-depth investigations into its enzymatic activity, structural characteristics, and interactions with RNA substrates. Understanding the functional mechanisms of RNASET2 could lead to innovative therapeutic strategies for diseases where RNA regulation is compromised. Consequently, the exploration of RNASET2 as a recombinant protein offers promising avenues for both basic research and potential clinical applications, making it a focal point of modern molecular biology studies.
