Cat: PA1000-7167

Recombinant Human TNFRSF7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFRSF7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TNFRSF7;TNFRSF7;CD27 antigen

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P26842

  • Expression Region

    1-260aa

  • AA Sequence

    MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLV KDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITA NAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHPQPTHLPYVSE MLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMF LVFTLAGALFLHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQED YRKPEPACSP

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TNFRSF7, also known as CD27, is a member of the tumor necrosis factor receptor superfamily that plays a crucial role in the immune system, particularly in regulating T cell proliferation, differentiation, and survival. It is expressed on the surface of T lymphocytes and is involved in the activation of both CD4+ and CD8+ T cells, linking costimulatory signals to effective immune responses. The binding of its ligand, CD70, enhances cellular responses, making CD27 a target for therapeutic interventions in various diseases, including cancer, autoimmune disorders, and infectious diseases. Research on recombinantly produced TNFRSF7 proteins aims to elucidate its structural characteristics and functional properties, providing insights into its role in immune regulation. The generation of recombinant TNFRSF7 allows for the study of its interaction with ligands and downstream signaling pathways in a controlled environment, facilitating the development of immunotherapeutic strategies that enhance T cell responses against tumors or modulate immune tolerance in autoimmune conditions. Moreover, understanding the biophysical properties and biological functions of TNFRSF7 can lead to the identification of novel biomarkers for immune status and potential targets for drug development. Consequently, the continued investigation of TNFRSF7 as a recombinant protein represents a critical step towards harnessing its potential for clinical applications in immunotherapy and enhancing our understanding of immune system dynamics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US