Analytical Data
-
Gene name
ECM1
- Application
-
Alternative Names
ECM1；Extracellular matrix Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16610
-
Expression Region
386-540aa
-
AA Sequence
HPPSPTRDECFARRAPYPNYDRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGLIHNMTARCCDLPFPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE
-
Molecular Weight
52.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ECM1 (Extracellular Matrix Protein 1) is a member of the extracellular matrix protein family, recognized for its crucial role in various biological processes, including cell adhesion, migration, and the regulation of tissue homeostasis. Research on ECM1 has gained momentum due to its involvement in key pathological conditions, such as fibrosis, cancer, and inflammatory diseases. The protein acts as a multifunctional glycoprotein that interacts with various components of the extracellular matrix, influencing cellular behaviors and tissue morphology. In recent studies, ECM1 has been highlighted for its potential as a biomarker for certain cancers, as well as its significance in modulating immune responses. Recombining ECM1 protein has emerged as a promising strategy to explore its functional properties, allowing researchers to investigate its molecular mechanisms more effectively. By producing recombinant ECM1 in model systems, scientists aim to dissect its interactions at the cellular level, paving the way for novel therapeutic approaches targeting ECM1-related pathways. Furthermore, understanding the structural and functional characteristics of ECM1 may contribute to the development of biomimetic materials for tissue engineering and regenerative medicine, underscoring the protein's importance in both basic research and clinical applications.
