Analytical Data
-
Gene name
CEP2
- Application
-
Alternative Names
Binder of Rho GTPases 1; BORG1; BORG1_HUMAN; CDC42 effector Protein (Rho GTPase binding) 2; Cdc42 effector Protein 2; Cdc42ep2; CEP2; CRIB-containing BOGR1 Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14613
-
Expression Region
1-210aa
-
AA Sequence
MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT
-
Molecular Weight
48.9 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CEP2, or Centrosomal Protein 2, is a crucial protein involved in the regulation of various cellular processes, particularly those related to the cell cycle and the maintenance of centrosome integrity. Research has indicated that CEP2 plays a significant role in microtubule organization, which is vital for proper cell division and overall cellular function. Abnormalities in CEP2 expression or function have been implicated in several diseases, including cancer, where its dysregulation can lead to aneuploidy and tumorigenesis. As a result, understanding the molecular mechanisms governing CEP2 activity and interactions is of paramount importance for elucidating its potential role as a biomarker or therapeutic target in cancer and other centrosome-related disorders. The recombinant expression of CEP2 in model organisms or cell lines provides a valuable platform for studying its structure-function relationships and developing targeted interventions. Investigating the dynamics of CEP2 in cellular contexts can help in identifying novel pathways that are involved in cell cycle regulation and centrosome stability, further shedding light on its contributions to cellular homeostasis and pathology. Thus, ongoing research into CEP2 not only aims to clarify its biological functions but also explores its therapeutic potential, making it a significant focus within the field of molecular and cellular biology.
