Analytical Data
-
Gene name
sacIM
- Application
-
Alternative Names
sacIM；Type II methyltransferase M.SacI
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O31073
-
Expression Region
1-390aa
-
AA Sequence
MNHELPVISLFSGAGGLDCAIESCAEPPLVQDGSGSPLRVAVATDYEQTALDTLSANFPHTKTLCGDIQTIPTAELLEAGGLKPGDPTLVIGGPPCTPFSKSGFWIEEKRNSADPNASLLDEYVRVVRESKPEAFILENVQGLTYKTHQAQFDRLIAGLKDAGYNPTFRVLLAAEYGVPQLRRRVFVVGRRDGKAFHFPETTHSGESERDRVIDHTKIPFTSLREALAGLPDVPEAGEVVEGTYAELAAEVPPGQNYLWHTDRYGGRNEFKWRSRYWTFLLKADPDRPSTTLQAQPGPWVGPFHWENVKNANGEERARRFRVAEMKRIMTFPDEFVFTGVKREVQRQIGNPVPVELGKVVVRALMEQLGYLDSRGTTIPSQAGHEQLELI
-
Molecular Weight
59.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of sacIM recombinant proteins has garnered significant attention in the field of protein engineering and biotechnology. SacIM, a member of the superfamily of aspartic proteases, is known for its distinctive catalytic mechanism and potential therapeutic applications. This enzyme plays a crucial role in various biological processes, and its understanding can lead to advances in drug design, particularly for diseases where protease activity is implicated. Recombinant protein technology allows for the efficient production and characterization of sacIM, enabling researchers to investigate its structure-function relationships in detail. By employing techniques such as molecular cloning and expression in various systems, scientists can optimize the yield and functionality of sacIM. Furthermore, this research opens avenues for exploring enzyme inhibition and modulation, contributing to the development of novel therapeutic agents. The growing importance of proteomics and biopharmaceuticals underscores the relevance of sacIM recombinant protein studies in both basic research and applied science, with the potential to address unmet medical needs and enhance our understanding of proteolytic enzymes.
