Analytical Data
-
Gene name
SVTLE
- Application
-
Alternative Names
SVTLE；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
F8S114
-
Expression Region
25-262aa
-
AA Sequence
VIGGDECNINEHRFLVALYDYWSQSFLCGGTLINEEWVLTAKHCDRTHILIYVGVHDRSVQFDKEQRRFPKEKYFFDCSNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRAMGWGQTTSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRTLCAGVLEGGIDTCNRDSGGPLICNGQFQGIVFWGPDPCAQPDKPGLYTKVFDHLDWIQSIIAGEKTVNCPP
-
Molecular Weight
42.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SVTLE (Serratia marcescens virulence factor that regulates the expression of type III secretion system) is a protein that has garnered significant attention in the field of microbiology and infectious disease research. The study of SVTLE is primarily contextualized within the pathogenic mechanisms of Serratia marcescens, a Gram-negative bacterium known for its role in nosocomial infections. SVTLE is believed to play a critical role in the bacterium's virulence by modulating the expression of its type III secretion system (T3SS), a needle-like structure that allows the bacterium to inject effector proteins into host cells, subverting host immune responses. The growing prevalence of antibiotic-resistant strains of Serratia marcescens and the limited therapeutic options available underscore the urgency of understanding the molecular underpinnings of its pathogenicity. Research on SVTLE not only aims to elucidate the specific regulatory mechanisms governing T3SS expression but also seeks to identify potential therapeutic targets to mitigate the effects of infections caused by this opportunistic pathogen. Discoveries in this area could pave the way for novel treatments and strategies to combat Serratia marcescens infections, particularly in vulnerable patient populations such as those in intensive care units. Consequently, the study of SVTLE serves as a critical intersection of microbiology, pathogenesis, and therapeutic development, highlighting the importance of basic research in addressing pressing clinical challenges in infectious diseases.
