Analytical Data
-
Gene name
CDCA5
- Application
-
Alternative Names
CDCA5; CDCA5_HUMAN; Cell division cycle associated Protein 5; Cell division cycle-associated Protein 5; MGC16386; p35; Sororin
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96FF9
-
Expression Region
1-252aa
-
AA Sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE
-
Molecular Weight
54 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDCA5 (Cell Division Cycle Associated 5) is a crucial protein involved in the regulation of cell division, particularly during the processes of mitosis and chromosome segregation. Research on CDCA5 has garnered interest due to its role in maintaining genomic stability and its potential implications in cancer biology. Abnormal expression or function of CDCA5 has been linked to various malignancies, suggesting that it may act as an oncogene. The study of CDCA5 recombinant proteins is pivotal for elucidating its structure-function relationships and interactions with other mitotic regulators. By producing CDCA5 in a recombinant form, researchers can investigate its biochemical properties, cellular localization, and the mechanisms by which it influences cell cycle progression. Understanding CDCA5's role in the cell cycle could provide insights into novel therapeutic targets for cancer treatment, making it a significant focus in cancer research. Overall, the exploration of CDCA5 and its recombinant protein may contribute to the development of innovative strategies to combat cell division-related diseases, offering a promising avenue for future research and therapeutic advancements.
