Analytical Data
-
Gene name
CDCA4
- Application
-
Alternative Names
CDCA 4; Cdca4; CDCA4_HUMAN; Cell division cycle associated 4; Cell division cycle-associated Protein 4; FLJ20764; FLJ52878; Hematopoietic progenitor Protein; Hepp; MGC19517; SEI 3; SEI-3/HEPP; SEI3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BXL8
-
Expression Region
1-241aa
-
AA Sequence
MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAWGQEGAHPAPGLGDGHTQGPVSDLCPVTSAQAPRHLQSSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET
-
Molecular Weight
52.5 KDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDCA4, or Cell Division Cycle Associated 4, is a protein that plays a crucial role in regulating cell proliferation and division. Its expression is often associated with various types of cancers, where it may influence tumor growth and metastasis by affecting the cell cycle and apoptosis pathways. Research into CDCA4 has gained momentum due to its potential as a biomarker for cancer diagnosis and prognosis, as well as a target for therapeutic intervention. Studies have shown that altered expression levels of CDCA4 can correlate with tumor aggressiveness and patient outcomes, making it a significant focus for understanding tumor biology. Additionally, the investigation of CDCA4's molecular mechanisms has revealed its involvement in key cellular processes, such as the regulation of mitotic progression and chromosomal stability. The development of recombinant CDCA4 proteins is valuable for further dissecting its functional roles in various biological contexts, enabling researchers to explore its interactions with other cellular components and its impact on cancer pathology. Overall, the study of CDCA4 is an emerging field that holds promise for advancing cancer research and developing novel therapeutic strategies.











