Analytical Data
-
Gene name
COL6A6
- Application
-
Alternative Names
COL6A6；Collagen alpha-6(VI) chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NMZ7
-
Expression Region
430-982aa
-
AA Sequence
VDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPHKVRVGAVQYADSWDLEFEINKYSNKQDLGKAIENIRQMGGNTNTGAALNFTLSLLQKAKKQRGNKVPCHLVVLTNGMSKDSILEPANRLREEHIRVYAIGIKEANQTQLREIAGEEKRVYYVHDFDALKDIRNQVVQEICTEEACKEMKADIMFLVDSSGSIGPENFSKMKTFMKNLVSKSQIGPDRVQIGVVQFSDINKEEFQLNRFMSQSDISNAIDQMAHIGQTTLTGSALSFVSQYFSPTKGARPNIRKFLILITDGEAQDIVKEPAVVLRQEGVIIYSVGVFGSNVTQLEEISGRPEMVFYVENFDILQRIEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKADVGKNQVRFGALKYADDPEVLFYLDDFGTKLEVISVLQNDQAMGGSTYTAEALGFSDHMFTEARGSRLNKGVPQVLIVITDGESHDADKLNATAKALRDKGILVLAVGIDGANPVELLAMAGSSDKYFFVETFGGLKGIFSDV
-
Molecular Weight
63.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL6A6, a member of the collagen VI family, is a protein that plays a crucial role in the extracellular matrix (ECM), influencing tissue structure and function. The study of COL6A6 is essential because it is implicated in various biological processes, including cell adhesion, migration, and signaling pathways. Research indicates that COL6A6 is involved in the development and maintenance of connective tissues, and its dysregulation has been associated with several diseases, such as muscular dystrophies and tumor progression. The recombinant production of COL6A6 is significant for elucidating its functional properties and understanding its involvement in pathophysiological conditions. By utilizing advanced recombinant protein technology, scientists can generate purified COL6A6 for functional assays, structural characterization, and interaction studies with various ECM components and cell surface receptors. This research not only aids in the comprehensive understanding of collagen VI-related disorders but also paves the way for potential therapeutic interventions targeting COL6A6-related pathways. Detailed characterization of COL6A6 through recombinant protein studies can thus contribute to the broader field of collagen research and therapeutic development, providing insights into its biological roles and potential applications in regenerative medicine and tissue engineering.
