Analytical Data
-
Gene name
RRN3
- Application
-
Alternative Names
RNA polymerase I-specific transcription initiation factor RRN3. Transcription initiation factor IA. TIF-IA
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYV6
-
Expression Region
1-106 aa
-
AA Sequence
MRALENDFFNSPPRKTVRFGGTVTEVLLKYKKGETNDFELLKNQLLDPDIKDDQIINWLLEFRSSVMYLTKDFEQLISIILRLPWLNRSQTVVEEYLAFLGNLVSA
-
Molecular Weight
38.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RRN3, an essential regulatory protein, plays a crucial role in ribosomal RNA synthesis and ribosome biogenesis. It primarily functions in the nucleolus, where it interacts with RNA polymerase I to enhance the transcription of ribosomal RNA genes. Recent studies have highlighted the significance of RRN3 in various cellular processes, including cell growth, proliferation, and response to stress. Alterations in RRN3 expression and function have been linked to several diseases, including cancer, where dysregulation of ribosome production can contribute to enhanced cellular growth and survival. Understanding the molecular mechanisms underlying RRN3's function has become a focal point of research, as it may unveil potential therapeutic targets for diseases characterized by aberrant ribosome production. Furthermore, investigations into post-translational modifications and interactions with other nucleolar proteins have provided insights into the complex regulatory networks governing ribosome biogenesis. Given these facets, RRN3 stands out as a key player in maintaining cellular homeostasis and highlighting its potential as a biomarker for disease progression. Continued exploration of RRN3 could illuminate novel pathways for intervention in diseases influenced by ribosome dysregulation.
