Cat: PA1000-6359

Recombinant Human LCN1 Protein,HEK293

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LCN1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LCN1;VEGP;Lipocalin-1

  • Species

    Human

  • Source

    HEK293

  • Tag

    C- 10*His tag

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P31025

  • Expression Region

    19-176aa

  • AA Sequence

    HHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

  • Molecular Weight

    20-22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LCN1 (Lipocalin 1), also known as LgfA or β-Lactoglobulin, is a member of the lipocalin family, which is characterized by its ability to bind small hydrophobic molecules. It has a significant role in various physiological processes, including cellular differentiation, inflammation, and metabolic regulation. Research on LCN1 has gained attention due to its involvement in several pathological conditions, such as cancer and obesity, and its potential as a biomarker for disease progression. The recombinant production of LCN1 protein presents an opportunity to explore its biological functions and interactions in a controlled environment. By utilizing techniques such as recombinant DNA technology and protein expression systems, researchers can produce LCN1 in sufficient quantities for structural and functional studies. Such investigations aim to elucidate the protein's mechanisms of action, binding affinities, and therapeutic potentials. Understanding LCN1 at the molecular level could lead to innovative strategies for diagnosis and treatment of diseases where LCN1 plays a critical role, further emphasizing the importance of continued research on this intriguing protein.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US