Cat: PA1000-6303

Recombinant Human SIGLEC5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SIGLEC5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SIGLEC5;CD33L2;OBBP2;Sialic acid-binding Ig-like lectin 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O15389

  • Expression Region

    17-434aa

  • AA Sequence

    EKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYWFRDGEI PYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSY FFRVERGRDVKYSYQQNKLNLEVTALIEKPDIHFLEPLESGRPTRLSCSL PGSCEAGPPLTFSWTGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQMK RQGAQVTTERTVQLNVSYAPQTITIFRNGIALEILQNTSYLPVLEGQALR LLCDAPSNPPAHLSWFQGSPALNATPISNTGILELRRVRSAEEGGFTCRA QHPLGFLQIFLNLSVYSLPQLLGPSCSWEAEGLHCRCSFRARPAPSLCWR LEEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIY GSQSGSVLLLQGRSNLGT

  • Molecular Weight

    73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Siglec-5 is a member of the sialic acid-binding Ig-like lectin (Siglec) family, primarily expressed on immune cells such as macrophages and dendritic cells. It plays a crucial role in modulating immune responses and maintaining self-tolerance by interacting with sialylated ligands on cells. The study of Siglec-5 and its recombinant protein forms has gained attention due to its potential implications in various diseases, including autoimmune disorders, infections, and cancer. Research indicates that Siglec-5 can inhibit the activation of immune cells, thereby influencing inflammatory responses and the balance between tolerance and immunity. Recombinant Siglec-5 proteins are valuable tools for elucidating the mechanisms of action and interactions of this receptor, as well as for developing therapeutic strategies that target Siglec-5 pathways. By engineering and producing recombinant forms of Siglec-5, researchers aim to investigate its structure-function relationships, binding affinities to different sialylated ligands, and its role in modulating immune cell signaling. This research could lead to novel approaches in immunotherapy and provide insights into its role in immune regulation, ultimately contributing to the development of targeted treatments for various diseases. Understanding the biology of Siglec-5 through recombinant protein studies is a critical step toward leveraging its potential in medical applications. 

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US