Analytical Data
-
Gene name
RPL39L
- Application
-
Alternative Names
60S ribosomal protein L39-2;Large ribosomal subunit protein eL39-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96EH5
-
Expression Region
1-51 aa
-
AA Sequence
MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
-
Molecular Weight
33 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPL39L, a member of the ribosomal protein family, plays a critical role in ribosome biogenesis and protein synthesis in eukaryotic cells. This protein is primarily expressed in tissues with high metabolic activity, such as the brain and testes, suggesting its involvement in cellular growth and development. Recent studies have highlighted the potential link between RPL39L dysfunction and various developmental disorders and cancers, making it a target of increasing interest in biomedical research. Its unique features, including specific gene sequence and expression patterns, suggest that RPL39L may have distinct regulatory functions compared to its closely related paralogs. Consequently, recombinant RPL39L proteins have been produced to facilitate functional studies, elucidate its role in ribosome assembly, and investigate its interactions with other cellular components. Understanding the molecular mechanisms behind RPL39L's function could provide insights into the underlying causes of diseases associated with ribosomal dysfunction and enable the development of novel therapeutic strategies. This area of research is particularly relevant in the context of precision medicine, where targeting specific pathways mediated by ribosomal proteins may lead to more effective treatments for ribosomopathies and related conditions.
