Analytical Data
-
Gene name
ENTPD2
- Application
-
Alternative Names
ENTPD2；CD39L1；Ectonucleoside triphosphate diphosphohydrolase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5L3
-
Expression Region
1-495aa
-
AA Sequence
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ENTPD2, also known as ecto-nucleotide triphosphate diphosphohydrolase 2, is an important enzyme that plays a crucial role in the hydrolysis of ATP and other nucleotides in the extracellular environment. Its activity is implicated in various physiological processes, including cell signaling, inflammation, and immune responses. Studies have indicated that ENTPD2 may participate in the regulation of the purinergic signaling pathway, influencing various cellular functions, such as proliferation and apoptosis. Additionally, altered levels of ENTPD2 expression have been linked to several pathological conditions, including cancer and neurodegenerative diseases, highlighting its potential as a therapeutic target. The recombinant protein of ENTPD2 provides a valuable tool for investigating its enzymatic properties and biological functions in vitro and in vivo. By generating and characterizing ENTPD2 recombinants, researchers aim to elucidate the enzyme's mechanism of action, assess its substrate specificity, and explore its interactions with other proteins. This research has significant implications for understanding ENTPD2's role in health and disease, paving the way for the development of novel therapeutic strategies that may leverage its enzymatic functions. Furthermore, the study of ENTPD2 can contribute to the broader understanding of nucleotide metabolism and its implications in cellular homeostasis and pathophysiology. Overall, the ongoing research on ENTPD2 recombinant protein is essential for uncovering its biological roles and potential applications in medical science.
