Analytical Data
-
Gene name
recO
- Application
-
Alternative Names
recO；RCV1；Recoverin
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A7H3
-
Expression Region
1-242aa
-
AA Sequence
MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RecO is a crucial protein involved in the DNA repair and recombination processes, particularly in bacteria. It plays a significant role in the homologous recombination repair pathway, which is vital for maintaining genomic stability and integrity. The study of RecO is particularly important because it assists in the processing of single-stranded DNA, facilitating the search for homologous sequences during repair. Research on RecO has garnered attention due to its potential implications in understanding bacterial resistance mechanisms to antibiotics and its role in horizontal gene transfer, which contributes to the spread of resistance traits among bacterial populations. Additionally, understanding the function of RecO can provide insights into broader mechanisms of DNA repair and recombination that are conserved across different organisms, including humans. As a result, RecO has become a target for investigating novel therapeutic strategies to combat antibiotic resistance and enhance the efficacy of existing treatment modalities by manipulating bacterial DNA repair pathways. This growing interest in RecO and its functions underscores the importance of studying this protein not only for basic science but also for its potential applications in medical microbiology and genetic engineering. Moreover, elucidating the detailed mechanisms of RecO action may pave the way for innovative approaches in biotechnology and synthetic biology. Overall, the exploration of RecO’s role in recombination and repair mechanisms offers valuable opportunities for advancing our understanding of microbial genetics and developing new strategies to address public health challenges posed by antibiotic-resistant bacteria.
