Analytical Data
-
Gene name
RP42
- Application
-
Alternative Names
DCUN1D1; DCN1; DCUN1L1; RP42; SCCRODCN1-like protein 1; DCUN1 domain-containing protein 1; Defective in cullin neddylation protein 1-like protein 1; Squamous cell carcinoma-related oncogene
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96GG9
-
Expression Region
1-259 aa
-
AA Sequence
MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
-
Molecular Weight
46.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RP42 is a recombinant protein that has garnered attention due to its potential applications in various fields, including biotechnology and medicine. Derived from the ribosomal protein family, RP42 plays a crucial role in cellular processes such as protein synthesis and cellular growth. Understanding the structure and function of RP42 is significant because abnormalities in ribosomal proteins have been linked to diseases, including cancer and genetic disorders. Research on RP42 involves using advanced techniques in molecular biology, including recombinant DNA technology, to produce the protein in sufficient quantities for further study. This includes investigating its interactions with other cellular molecules and its role in the regulation of gene expression. By exploring the biophysical properties and biological functions of RP42, scientists hope to elucidate its mechanisms of action and potential therapeutic targets. Additionally, RP42's stability and functionality make it an ideal candidate for developing novel biomaterials, drug delivery systems, and therapeutic agents. Thus, ongoing studies on RP42 not only enhance our understanding of ribosomal function but also pave the way for innovative approaches in treating diseases related to ribosomal protein defects.
