Analytical Data
-
Gene name
Hbb-b2
- Application
-
Alternative Names
Hbb-b2；Hemoglobin subunit beta
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02089
-
Expression Region
2-147aa
-
AA Sequence
VHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
-
Molecular Weight
17.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Hbb-b2 recombinant protein has garnered significant attention in recent years, primarily due to its pivotal role in the study of hemoglobinopathies and the development of gene therapies. The Hbb-b2 gene encodes the beta-globin subunit of hemoglobin, which is essential for oxygen transport in the blood. Mutations in this gene are associated with various disorders, including beta-thalassemia and sickle cell disease. Understanding the structure and function of Hbb-b2 is crucial for developing therapeutic strategies aimed at correcting these genetic defects. Researchers have focused on producing Hbb-b2 recombinant protein to facilitate the study of its interactions with other hemoglobin subunits, assess the molecular mechanisms underlying hemoglobin disorders, and explore potential gene-editing techniques such as CRISPR/Cas9 for therapeutic interventions. Furthermore, recombinant Hbb-b2 can serve as a valuable tool in drug discovery and in the screening of potential pharmacological agents that might enhance the production of functional hemoglobin in affected individuals. This body of research not only deepens our understanding of hemoglobin function but also represents a promising avenue for innovative treatments for blood-related diseases.
