Analytical Data
-
Gene name
MTSS1
- Application
-
Alternative Names
MTSS1；KIAA0429；MIM；Protein MTSS 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43312
-
Expression Region
1-250aa
-
AA Sequence
MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQK VADMATNTRGGTREIGSALTRMCMRHRSIEAKLRQFSSALIDCLINPLQEQMEEWKKVAN QLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKGRGDIQPQLDSALQDVNDKYLLLEETE KQAVRKALIEERGRFCTFISMLRPVIEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSS EQVILDLKGS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MTSS1, or Metastasis Suppressor 1, is a key player in the regulation of cell motility and invasion, processes critical to cancer metastasis. This protein was first identified for its role in inhibiting the spread of cancer cells, particularly in breast and colorectal cancer contexts. Studies have shown that MTSS1 functions as a scaffold protein, linking various signaling pathways involved in cytoskeletal dynamics and cell signaling. Its expression is often downregulated in aggressive tumors, suggesting that restoring MTSS1 levels could potentially suppress tumor progression. Furthermore, MTSS1 has been implicated in cellular processes such as epithelial-to-mesenchymal transition (EMT), which is associated with increased metastatic potential. Research into the biochemical properties and functional mechanisms of MTSS1 is crucial for understanding its role in cancer biology. By elucidating its interactions with other signaling molecules and pathways, scientists aim to uncover novel therapeutic targets for preventing or slowing metastasis. Ongoing studies also explore the potential of using MTSS1 as a biomarker for cancer prognosis and treatment response, reinforcing its significance in cancer research. Overall, the investigation of MTSS1 and its biological functions provides valuable insights into cancer metastasis and offers promising avenues for developing clinical interventions.
