Analytical Data
-
Gene name
lptC
- Application
-
Alternative Names
lptC；yrbK；Lipopolysaccharide export system Protein LptC
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0ADW0
-
Expression Region
1-191aa
-
AA Sequence
MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP
-
Molecular Weight
23.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LptC is a crucial protein involved in the assembly and transport of lipopolysaccharides (LPS) in Gram-negative bacteria, which play a vital role in the structural integrity of the bacterial outer membrane and are key determinants of bacterial virulence. The study of LptC and its function has garnered significant interest due to the increasing prevalence of antibiotic resistance in Gram-negative pathogens, which poses a serious threat to public health. Understanding the mechanisms underlying LPS biogenesis and the role of LptC can aid in the development of novel antibiotic strategies that target this essential process. Recent advances in recombinant DNA technology have enabled the expression and purification of recombinant LptC, which can be utilized for structural and functional analyses. Investigating the interactions of LptC with other components of the LPS transport machinery provides insights into its role in the overall assembly line of lipopolysaccharide synthesis and transport. Moreover, elucidating the structure-function relationship of LptC may reveal potential targets for inhibitors that could disrupt LPS transport, leading to increased susceptibility of pathogenic bacteria to antibiotics. Consequently, research on LptC as a model system not only contributes to our fundamental understanding of bacterial physiology but also holds promise for the development of new therapeutic strategies to combat multi-drug resistant infections.
